PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca062674G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 145aa    MW: 15803 Da    PI: 5.1169
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca062674G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1444.7e-1499144348
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      + +r+rr++kNRe+A rsR+RK+a++ eLe  +  Le+eN+ L ke
  Gh_Sca062674G01  99 AQQRQRRMIKNRESAARSRERKQAYQVELESLAVRLEEENEWLLKE 144
                      679**************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.003897144IPR004827Basic-leucine zipper domain
PfamPF001701.8E-1299144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.28999145IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.87E-9101144No hitNo description
CDDcd147075.08E-17101143No hitNo description
Gene3DG3DSA:1.20.5.1708.5E-12102144No hitNo description
PROSITE patternPS000360104119IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MKEEVPDEMM TLEDFLAKAG AVEEAAAVAS AEVKLHPDRL SGGVYTFDPV GGGAFQILDK  60
MEGSIVGLGN GMEVIGSGGG GGRGKRGRGV LMEPLDKAAQ QRQRRMIKNR ESAARSRERK  120
QAYQVELESL AVRLEEENEW LLKEK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.180110.0ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6517850.0EF651785.1 Gossypium hirsutum transcription factor TF3 (TF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482413.11e-99PREDICTED: G-box-binding factor 4 isoform X2
SwissprotP427773e-40GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A0B0PRP61e-100A0A0B0PRP6_G
STRINGVIT_18s0072g00470.t012e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.16e-25bZIP family protein